1 2

Cagrilintide

Cagrilintide

$95.00
$135.00 $95.00
Sale Sold out
Shipping calculated at checkout.

What is Cagrilintide?

Cagrilintide is a synthetic long-acting analog of the naturally occurring hormone amylin. Amylin is co-secreted with insulin by pancreatic beta cells and plays a critical role in regulating appetite and glucose metabolism. Cagrilintide is specifically designed to target the amylin receptor, promoting satiety and reducing food intake.

Currently under clinical investigation, Cagrilintide has shown promise in the treatment of obesity and metabolic disorders when used alone or in combination with other weight-loss agents such as GLP-1 receptor agonists like semaglutide. Its extended half-life allows for once-weekly dosing, making it a convenient option for research into long-term weight management strategies.

Size

Free shipping in the US for orders $150+

Third Party Tested

Money Back Guaranteed

Satisfaction Guaranteed

Easy Return

Secure Ordering

View full details

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

Cagrilintide Description

Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

Cagrilintide Peptide Structure

Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C194H312N54O59S2
Molecular Weight: 4409 g/mol
PubChem CID:  171397054
Synonyms:

  • 1415456-99-3
  • Cagrilintide [INN]
  • AO43BIF1U8
  • LDERDVMBIYGIOI-IZVMHKDJSA-N

Research Areas:

  • Weight Management
  • Glycemic Control
  • Cardiovascular Health

Source: PubChem

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

Why Choose Us?

Third-Party Tested

Third-party tested for identity, purity, & concentration

Free Shipping

Free shipping in the US for orders $150+

Satisfaction Guarantee

We guarantee you will be satisfied or your money back

Subscribe For Updates

Subscribe to our email and for our latest updates, product releases and offers.